Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries) |
Domain d1bqhd1: 1bqh D:182-274 [20801] Other proteins in same PDB: d1bqha2, d1bqhd2, d1bqhg_, d1bqhh_, d1bqhi_, d1bqhk_ complexed with nag |
PDB Entry: 1bqh (more details), 2.8 Å
SCOP Domain Sequences for d1bqhd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bqhd1 b.1.1.2 (D:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d1bqhd1: