Lineage for d1bqhd1 (1bqh D:182-274)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 158811Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 159007Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (22 PDB entries)
  8. 159044Domain d1bqhd1: 1bqh D:182-274 [20801]
    Other proteins in same PDB: d1bqha2, d1bqhd2, d1bqhg_, d1bqhh_, d1bqhi_, d1bqhk_

Details for d1bqhd1

PDB Entry: 1bqh (more details), 2.8 Å

PDB Description: murine cd8aa ectodomain fragment in complex with h-2kb/vsv8

SCOP Domain Sequences for d1bqhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqhd1 b.1.1.2 (D:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1bqhd1:

Click to download the PDB-style file with coordinates for d1bqhd1.
(The format of our PDB-style files is described here.)

Timeline for d1bqhd1: