Lineage for d2zyda2 (2zyd A:177-466)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742411Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1742412Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1742617Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1742618Protein automated matches [226851] (30 species)
    not a true protein
  7. 1742655Species Escherichia coli K-12 [TaxId:83333] [225711] (3 PDB entries)
  8. 1742658Domain d2zyda2: 2zyd A:177-466 [208009]
    Other proteins in same PDB: d2zyda1, d2zydb1
    automated match to d1pgja1
    complexed with glo

Details for d2zyda2

PDB Entry: 2zyd (more details), 1.5 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with glucose
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2zyda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zyda2 a.100.1.0 (A:177-466) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditk
diftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqr
vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygei
akifragciiraqflqkitdacaenpqianlllapyfkqiaddyqqalrdvvayavqngi
pvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtew

SCOPe Domain Coordinates for d2zyda2:

Click to download the PDB-style file with coordinates for d2zyda2.
(The format of our PDB-style files is described here.)

Timeline for d2zyda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zyda1