Class a: All alpha proteins [46456] (286 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (30 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225711] (3 PDB entries) |
Domain d2zyda2: 2zyd A:177-466 [208009] Other proteins in same PDB: d2zyda1, d2zydb1 automated match to d1pgja1 complexed with glo |
PDB Entry: 2zyd (more details), 1.5 Å
SCOPe Domain Sequences for d2zyda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zyda2 a.100.1.0 (A:177-466) automated matches {Escherichia coli K-12 [TaxId: 83333]} gaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditk diftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqr vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygei akifragciiraqflqkitdacaenpqianlllapyfkqiaddyqqalrdvvayavqngi pvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtew
Timeline for d2zyda2: