SCOPe 2.03: Domain d2zyaa2: 2zya A:177-466

Lineage for d2zyaa2 (2zya A:177-466)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [225711] (3 PDB entries)

8. Domain d2zyaa2: 2zya A:177-466 [208005]
   Other proteins in same PDB: d2zyaa1, d2zyab1
   automated match to d1pgja1
   complexed with 6pg

Details for d2zyaa2

PDB Entry: 2zya, 1.6 Å

PDB Description: dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate

PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d2zyaa2:

Sequence; same for both SEQRES and ATOM records:

>d2zyaa2 a.100.1.0 (A:177-466) automated matches {Escherichia coli [TaxId: 83333]}
gaghyvkmvhngieygdmqliaeaysllkgglnltneelaqtftewnngelssyliditk
diftkkdedgnylvdvildeaankgtgkwtsqsaldlgeplslitesvfaryisslkdqr
vaaskvlsgpqaqpagdkaefiekvrralylgkivsyaqgfsqlraaseeynwdlnygei
akifragciiraqflqkitdacaenpqianlllapyfkqiaddyqqalrdvvayavqngi
pvptfsaavayydsyraavlpanliqaqrdyfgahtykridkegvfhtew

Timeline for d2zyaa2:

• d2zyaa2 is new in SCOPe 2.03-stable
  
• d2zyaa2 appears in SCOPe 2.04
  
• d2zyaa2 appears in the current release, SCOPe 2.08