SCOPe 2.06: Domain d2zwja_: 2zwj A:

Lineage for d2zwja_ (2zwj A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (21 species)
   not a true protein

7. Species Tokunagayusurika akamusi [TaxId:28383] [188112] (10 PDB entries)

8. Domain d2zwja_: 2zwj A: [207995]
   automated match to d1x3ka_
   complexed with hem

Details for d2zwja_

PDB Entry: 2zwj, 1.81 Å

PDB Description: Crystal structure of a hemoglobin component V from Propsilocerus akamusi (pH4.6 coordinates)

PDB Compounds: (A:) hemoglobin v

SCOPe Domain Sequences for d2zwja_:

Sequence; same for both SEQRES and ATOM records:

>d2zwja_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}
afvglsdseeklvrdawapihgdlqgtantvfynylkkypsnqdkfetlkghpldevkdt
anfkliagriftifdncvknvgndkgfqkviadmsgphvarpithgsyndlrgviydsmh
ldsthgaawnkmmdnffyvfyecldgrcsqfs

Timeline for d2zwja_:

• d2zwja_ first appeared in SCOPe 2.03
  
• d2zwja_ appears in SCOPe 2.05
  
• d2zwja_ appears in SCOPe 2.07
  
• d2zwja_ appears in the current release, SCOPe 2.08