SCOPe 2.01: Domain d1fo0l_: 1fo0 L:

Lineage for d1fo0l_ (1fo0 L:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
   Uniprot P01887

8. Domain d1fo0l_: 1fo0 L: [20798]
   Other proteins in same PDB: d1fo0a_, d1fo0b_, d1fo0h1, d1fo0h2

Details for d1fo0l_

PDB Entry: 1fo0, 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

PDB Compounds: (L:) protein (beta-2 microglobulin)

SCOPe Domain Sequences for d1fo0l_:

Sequence; same for both SEQRES and ATOM records:

>d1fo0l_ b.1.1.2 (L:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1fo0l_:

• d1fo0l_ first appeared (with stable ids) in SCOP 1.55, called d1fo0l1
  
• d1fo0l_ appears in SCOP 1.75
  
• d1fo0l_ appears in SCOPe 2.02
  
• d1fo0l_ appears in the current release, SCOPe 2.08