Lineage for d1fo0l_ (1fo0 L:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220647Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries)
  8. 220681Domain d1fo0l_: 1fo0 L: [20798]
    Other proteins in same PDB: d1fo0a_, d1fo0b_, d1fo0h2

Details for d1fo0l_

PDB Entry: 1fo0 (more details), 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex
PDB Compounds: (L:)

SCOP Domain Sequences for d1fo0l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fo0l_ b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1fo0l_:

Click to download the PDB-style file with coordinates for d1fo0l_.
(The format of our PDB-style files is described here.)

Timeline for d1fo0l_: