SCOP 1.63: Domain d1fo0l_: 1fo0 L:

Lineage for d1fo0l_ (1fo0 L:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (23 PDB entries)

8. Domain d1fo0l_: 1fo0 L: [20798]
   Other proteins in same PDB: d1fo0a_, d1fo0b_, d1fo0h2

Details for d1fo0l_

PDB Entry: 1fo0, 2.5 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1fo0l_:

Sequence; same for both SEQRES and ATOM records:

>d1fo0l_ b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1fo0l_:

• d1fo0l_ first appeared (with stable ids) in SCOP 1.55, called d1fo0l1
  
• d1fo0l_ was called d1fo0l1 in SCOP 1.61
  
• d1fo0l_ appears in SCOP 1.65
  
• d1fo0l_ appears in the current release, SCOPe 2.08