SCOPe 2.04: Domain d2zqzf2: 2zqz F:163-330

Lineage for d2zqzf2 (2zqz F:163-330)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (19 species)

7. Species Lactobacillus casei [TaxId:1582] [56345] (6 PDB entries)

8. Domain d2zqzf2: 2zqz F:163-330 [207960]
   Other proteins in same PDB: d2zqza1, d2zqzb1, d2zqzc1, d2zqzd1, d2zqze1, d2zqzf1
   automated match to d1llca2
   complexed with so4

Details for d2zqzf2

PDB Entry: 2zqz, 2.5 Å

PDB Description: R-state structure of allosteric L-lactate dehydrogenase from Lactobacillus casei

PDB Compounds: (F:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2zqzf2:

Sequence; same for both SEQRES and ATOM records:

>d2zqzf2 d.162.1.1 (F:163-330) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
tsldtarfrqsiaemvnvdarsvhayimgehgdtefpvwshaniggvtiaewvkahpeik
edklvkmfedvrdaayeiiklkgatfygiatalariskailndenavlplsvymdgqygl
ndiyigtpavinrngiqnileipltdheeesmqksasqlkkvltdafa

Timeline for d2zqzf2:

• d2zqzf2 first appeared in SCOPe 2.03
  
• d2zqzf2 appears in SCOPe 2.05
  
• d2zqzf2 appears in the current release, SCOPe 2.08