![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
![]() | Protein Lactate dehydrogenase [51859] (18 species) |
![]() | Species Lactobacillus casei [TaxId:1582] [51865] (6 PDB entries) |
![]() | Domain d2zqzb1: 2zqz B:17-162 [207951] Other proteins in same PDB: d2zqza2, d2zqzb2, d2zqzc2, d2zqzd2, d2zqze2, d2zqzf2 automated match to d1llca1 complexed with so4 |
PDB Entry: 2zqz (more details), 2.5 Å
SCOPe Domain Sequences for d2zqzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zqzb1 c.2.1.5 (B:17-162) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} dkdhqkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkk iysaeysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaa npvdiltyatwklsgfpknrvvgsg
Timeline for d2zqzb1: