Lineage for d1osza1 (1osz A:182-274)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8170Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 8326Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (11 PDB entries)
  8. 8337Domain d1osza1: 1osz A:182-274 [20795]
    Other proteins in same PDB: d1osza2

Details for d1osza1

PDB Entry: 1osz (more details), 2.1 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and an (l4v) mutant of the vesicular stomatitis virus nucleoprotein

SCOP Domain Sequences for d1osza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osza1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1osza1:

Click to download the PDB-style file with coordinates for d1osza1.
(The format of our PDB-style files is described here.)

Timeline for d1osza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1osza2
View in 3D
Domains from other chains:
(mouse over for more information)
d1oszb1