SCOPe 2.08: Domain d2zqyb1: 2zqy B:21-162

Lineage for d2zqyb1 (2zqy B:21-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Lactobacillus casei [TaxId:1582] [51865] (4 PDB entries)

8. Domain d2zqyb1: 2zqy B:21-162 [207943]
   Other proteins in same PDB: d2zqya2, d2zqyb2, d2zqyc2, d2zqyd2
   automated match to d1llca1
   complexed with no3

Details for d2zqyb1

PDB Entry: 2zqy, 2.6 Å

PDB Description: T-state structure of allosteric L-lactate dehydrogenase from Lactobacillus casei

PDB Compounds: (B:) l-lactate dehydrogenase

SCOPe Domain Sequences for d2zqyb1:

Sequence; same for both SEQRES and ATOM records:

>d2zqyb1 c.2.1.5 (B:21-162) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]}
qkvilvgdgavgssyayamvlqgiaqeigivdifkdktkgdaidlsnalpftspkkiysa
eysdakdadlvvitagapqkpgetrldlvnknlkilksivdpivdsgfngiflvaanpvd
iltyatwklsgfpknrvvgsg

Timeline for d2zqyb1:

• d2zqyb1 first appeared in SCOPe 2.03
  
• d2zqyb1 appears in SCOPe 2.07