Lineage for d1kbgl1 (1kbg L:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) 
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (15 PDB entries) 
Domain d1kbgl1: 1kbg L: [20794]
Other proteins in same PDB: d1kbgh2
Details for d1kbgl1
PDB Entry: 1kbg (more details), 2.2 Å
PDB Description: mhc class i h-2kb presented glycopeptide rgy8-6h-gal2
SCOP Domain Sequences for d1kbgl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbgl1 b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
SCOP Domain Coordinates for d1kbgl1:
Click to download the PDB-style file with coordinates for d1kbgl1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kbgl1:
- d1kbgl1 first appeared (with stable ids) in SCOP 1.55
- d1kbgl1 appears in SCOP 1.59
- d1kbgl1 appears in the current release, SCOPe 2.08, called d1kbgl_
View in 3D
