Lineage for d1kbgh1 (1kbg H:182-274)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1759808Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1760095Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
    Uniprot P01901 22-299
  8. 1760155Domain d1kbgh1: 1kbg H:182-274 [20793]
    Other proteins in same PDB: d1kbgh2, d1kbgl_
    complexed with nag

Details for d1kbgh1

PDB Entry: 1kbg (more details), 2.2 Å

PDB Description: mhc class i h-2kb presented glycopeptide rgy8-6h-gal2
PDB Compounds: (H:) protein (major histocompatibility complex class I antigen h-2kb)

SCOPe Domain Sequences for d1kbgh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbgh1 b.1.1.2 (H:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOPe Domain Coordinates for d1kbgh1:

Click to download the PDB-style file with coordinates for d1kbgh1.
(The format of our PDB-style files is described here.)

Timeline for d1kbgh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kbgh2
View in 3D
Domains from other chains:
(mouse over for more information)
d1kbgl_