Lineage for d1kbgh1 (1kbg H:182-274)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103286Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 103477Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (15 PDB entries)
  8. 103494Domain d1kbgh1: 1kbg H:182-274 [20793]
    Other proteins in same PDB: d1kbgh2

Details for d1kbgh1

PDB Entry: 1kbg (more details), 2.2 Å

PDB Description: MHC Class I H-2KB Presented Glycopeptide RGY8-6H-GAL2

SCOP Domain Sequences for d1kbgh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbgh1 b.1.1.2 (H:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOP Domain Coordinates for d1kbgh1:

Click to download the PDB-style file with coordinates for d1kbgh1.
(The format of our PDB-style files is described here.)

Timeline for d1kbgh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kbgh2
View in 3D
Domains from other chains:
(mouse over for more information)
d1kbgl1