SCOP 1.65: Domain d1vacb_: 1vac B:

Lineage for d1vacb_ (1vac B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (48 PDB entries)

8. Domain d1vacb_: 1vac B: [20792]
   Other proteins in same PDB: d1vaca1, d1vaca2

Details for d1vacb_

PDB Entry: 1vac, 2.5 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and chicken ovalbumin

SCOP Domain Sequences for d1vacb_:

Sequence; same for both SEQRES and ATOM records:

>d1vacb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1vacb_:

• d1vacb_ first appeared (with stable ids) in SCOP 1.55, called d1vacb1
  
• d1vacb_ appears in SCOP 1.63
  
• d1vacb_ appears in SCOP 1.67
  
• d1vacb_ appears in the current release, SCOPe 2.08