SCOPe 2.04: Domain d2znwa1: 2znw A:1-106

Lineage for d2znwa1 (2znw A:1-106)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2znwa1: 2znw A:1-106 [207888]
   Other proteins in same PDB: d2znwy_, d2znwz_
   automated match to d1h8na1
   complexed with 1pg

Details for d2znwa1

PDB Entry: 2znw, 2.71 Å

PDB Description: crystal structure of scfv10 in complex with hen egg lysozyme

PDB Compounds: (A:) ScFv10

SCOPe Domain Sequences for d2znwa1:

Sequence; same for both SEQRES and ATOM records:

>d2znwa1 b.1.1.0 (A:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspatlsvtpgnsvslscrasqsignnlhwyqqkshesprllikyasqsisgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswpytfgggtklei

Timeline for d2znwa1:

• d2znwa1 first appeared in SCOPe 2.03
  
• d2znwa1 appears in SCOPe 2.05
  
• d2znwa1 appears in the current release, SCOPe 2.08