SCOPe 2.06: Domain d2zn9a_: 2zn9 A:

Lineage for d2zn9a_ (2zn9 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (51 PDB entries)

8. Domain d2zn9a_: 2zn9 A: [207879]
   automated match to d1juoa_
   complexed with 12p, 2pe, ca

Details for d2zn9a_

PDB Entry: 2zn9, 2.4 Å

PDB Description: Crystal structure of Ca2+-bound form of des3-20ALG-2

PDB Compounds: (A:) programmed cell death protein 6

SCOPe Domain Sequences for d2zn9a_:

Sequence; same for both SEQRES and ATOM records:

>d2zn9a_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alpdqsflwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagv
nfseftgvwkyitdwqnvfrtydrdnsgmidknelkqalsgfgyrlsdqfhdilirkfdr
qgrgqiafddfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfs

Timeline for d2zn9a_:

• d2zn9a_ first appeared in SCOPe 2.03
  
• d2zn9a_ appears in SCOPe 2.05
  
• d2zn9a_ appears in SCOPe 2.07
  
• d2zn9a_ appears in the current release, SCOPe 2.08