Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186924] (11 PDB entries) |
Domain d2zmea1: 2zme A:34-175 [207872] automated match to d1u5ta1 |
PDB Entry: 2zme (more details), 2.9 Å
SCOPe Domain Sequences for d2zmea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zmea1 a.4.5.0 (A:34-175) automated matches {Human (Homo sapiens) [TaxId: 9606]} aqmskqldmfktnleefaskhkqeirknpefrvqfqdmcatigvdplasgkgfwsemlgv gdfyyelgvqiievclalkhrngglitleelhqqvlkgrgkfaqdvsqddliraikklka lgtgfgiipvggtyliqsvpae
Timeline for d2zmea1: