SCOPe 2.03: Domain d2zmea1: 2zme A:34-175

Lineage for d2zmea1 (2zme A:34-175)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (41 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186924] (7 PDB entries)

8. Domain d2zmea1: 2zme A:34-175 [207872]
   automated match to d1u5ta1

Details for d2zmea1

PDB Entry: 2zme, 2.9 Å

PDB Description: Integrated structural and functional model of the human ESCRT-II complex

PDB Compounds: (A:) Vacuolar-sorting protein SNF8

SCOPe Domain Sequences for d2zmea1:

Sequence; same for both SEQRES and ATOM records:

>d2zmea1 a.4.5.0 (A:34-175) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqmskqldmfktnleefaskhkqeirknpefrvqfqdmcatigvdplasgkgfwsemlgv
gdfyyelgvqiievclalkhrngglitleelhqqvlkgrgkfaqdvsqddliraikklka
lgtgfgiipvggtyliqsvpae

Timeline for d2zmea1:

• d2zmea1 is new in SCOPe 2.03-stable
  
• d2zmea1 appears in SCOPe 2.04
  
• d2zmea1 appears in the current release, SCOPe 2.08