SCOPe 2.04: Domain d2zkhl1: 2zkh L:1-107

Lineage for d2zkhl1 (2zkh L:1-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (40 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d2zkhl1: 2zkh L:1-107 [207870]
   Other proteins in same PDB: d2zkhh1, d2zkhh2, d2zkhl2
   automated match to d1v7ml1

Details for d2zkhl1

PDB Entry: 2zkh, 2.04 Å

PDB Description: human thrombopoietin neutralizing antibody tn1 fab

PDB Compounds: (L:) Monoclonal TN1 Fab Light Chain

SCOPe Domain Sequences for d2zkhl1:

Sequence; same for both SEQRES and ATOM records:

>d2zkhl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikr

Timeline for d2zkhl1:

• d2zkhl1 first appeared in SCOPe 2.03
  
• d2zkhl1 appears in SCOPe 2.05
  
• d2zkhl1 appears in the current release, SCOPe 2.08