Lineage for d2zjoa1 (2zjo A:187-325)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2872042Species Hepatitis C virus (isolate taiwan) [TaxId:31645] [225627] (1 PDB entry)
  8. 2872043Domain d2zjoa1: 2zjo A:187-325 [207866]
    Other proteins in same PDB: d2zjoa2
    automated match to d1heia1
    complexed with bht

Details for d2zjoa1

PDB Entry: 2zjo (more details), 2.5 Å

PDB Description: Crystal structure of hepatitis C virus NS3 helicase with a novel inhibitor
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d2zjoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjoa1 c.37.1.0 (A:187-325) automated matches {Hepatitis C virus (isolate taiwan) [TaxId: 31645]}
nssppavpqafqvahlhaptgsgkstkvpaayaaqgykvlvlnpsvaatlgfgaymskah
gvdpnirtgvrtittgapitystygkfladggcsggaydiimcdechstdsttilgigtv
ldqaetagarlvvlatatp

SCOPe Domain Coordinates for d2zjoa1:

Click to download the PDB-style file with coordinates for d2zjoa1.
(The format of our PDB-style files is described here.)

Timeline for d2zjoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zjoa2