SCOPe 2.06: Domain d2vaab_: 2vaa B:

Lineage for d2vaab_ (2vaa B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (6 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries)
   Uniprot P01887

8. Domain d2vaab_: 2vaa B: [20786]
   Other proteins in same PDB: d2vaaa1, d2vaaa2

Details for d2vaab_

PDB Entry: 2vaa, 2.3 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and vesicular stomatitis virus nucleoprotein

PDB Compounds: (B:) beta-2 microglobulin

SCOPe Domain Sequences for d2vaab_:

Sequence; same for both SEQRES and ATOM records:

>d2vaab_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d2vaab_:

• d2vaab_ first appeared (with stable ids) in SCOP 1.55, called d2vaab1
  
• d2vaab_ appears in SCOPe 2.05
  
• d2vaab_ appears in SCOPe 2.07
  
• d2vaab_ appears in the current release, SCOPe 2.08