Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Thermococcus kodakarensis [TaxId:69014] [225454] (4 PDB entries) |
Domain d2zf5y2: 2zf5 Y:248-494 [207849] automated match to d3ezwd2 |
PDB Entry: 2zf5 (more details), 2.4 Å
SCOPe Domain Sequences for d2zf5y2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zf5y2 c.55.1.0 (Y:248-494) automated matches {Thermococcus kodakarensis [TaxId: 69014]} aafeagmvkatygtgsfilvntdkmvlysdnllttiawglngrvsyalegsifvtgaavq wlrdgikiikhaseteelatklesnegvyfvpafvglgapywdqfargiiigitrgtgre hlaratleaiayltrdvvdemeklvqikelrvdggatandflmqfqadilnrkvirpvvk ettalgaaylaglavdywadtreiaelwkaerifepkmdektrerlykgwkeavkramgw akvvdsa
Timeline for d2zf5y2: