Lineage for d2zejb_ (2zej B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597921Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 1597922Protein automated matches [190123] (79 species)
    not a true protein
  7. 1598123Species Human (Homo sapiens) [TaxId:9606] [186862] (95 PDB entries)
  8. 1598180Domain d2zejb_: 2zej B: [207845]
    automated match to d1wa5a_
    complexed with gdp, mg

Details for d2zejb_

PDB Entry: 2zej (more details), 2 Å

PDB Description: structure of the roc domain from the parkinson's disease-associated leucine-rich repeat kinase 2 reveals a dimeric gtpase
PDB Compounds: (B:) Leucine-rich repeat kinase 2

SCOPe Domain Sequences for d2zejb_:

Sequence, based on SEQRES records: (download)

>d2zejb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mklmivgntgsgkttllqqlmktkksdlgmqsatvgidvkdwpiqirdkrkrdlvlnvwd
fagreefysthphfmtqralylavydlskgqaevdamkpwlfnikarassspvilvgthl
dvsdekqrkacmskitkellnkrgfpairdyhfvnateesdalaklrktiineslnfk

Sequence, based on observed residues (ATOM records): (download)

>d2zejb_ c.37.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mklmivgntgsgkttllqqlmktqsatvgidvkdwpilvlnvwdfagreefysthphfmt
qralylavydlskgqaevdamkpwlfnikarassspvilvgthldvsdekqrkacmskit
kellnkrgfpairdyhfvnateesdalaklrktiineslnfk

SCOPe Domain Coordinates for d2zejb_:

Click to download the PDB-style file with coordinates for d2zejb_.
(The format of our PDB-style files is described here.)

Timeline for d2zejb_: