Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (32 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225373] (6 PDB entries) |
Domain d2zdqb2: 2zdq B:115-319 [207841] Other proteins in same PDB: d2zdqa1, d2zdqb1 automated match to d1e4ea2 complexed with atp, dal |
PDB Entry: 2zdq (more details), 2.3 Å
SCOPe Domain Sequences for d2zdqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zdqb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm yprlfeaggvaypellrrlvelalt
Timeline for d2zdqb2: