Lineage for d2zdqa2 (2zdq A:115-319)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541793Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2541794Protein automated matches [226904] (37 species)
    not a true protein
  7. 2541928Species Thermus thermophilus [TaxId:300852] [346384] (4 PDB entries)
  8. 2541937Domain d2zdqa2: 2zdq A:115-319 [207839]
    Other proteins in same PDB: d2zdqa1, d2zdqb1
    automated match to d1e4ea2
    complexed with atp, dal

Details for d2zdqa2

PDB Entry: 2zdq (more details), 2.3 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ATP and D-Alanine:D-Alanine from Thermus thermophius HB8
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zdqa2 d.142.1.0 (A:115-319) automated matches {Thermus thermophilus [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

SCOPe Domain Coordinates for d2zdqa2:

Click to download the PDB-style file with coordinates for d2zdqa2.
(The format of our PDB-style files is described here.)

Timeline for d2zdqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zdqa1