Lineage for d2zdhd2 (2zdh D:115-319)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671104Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1671105Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1671442Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1671443Protein automated matches [226904] (25 species)
    not a true protein
  7. 1671528Species Thermus thermophilus HB8 [TaxId:300852] [225373] (6 PDB entries)
  8. 1671532Domain d2zdhd2: 2zdh D:115-319 [207837]
    Other proteins in same PDB: d2zdha1, d2zdhb1, d2zdhc1, d2zdhd1
    automated match to d1e4ea2
    complexed with adp, dal, mg

Details for d2zdhd2

PDB Entry: 2zdh (more details), 1.9 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ADP and D-Alanine from Thermus thermophius HB8
PDB Compounds: (D:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zdhd2 d.142.1.0 (D:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

SCOPe Domain Coordinates for d2zdhd2:

Click to download the PDB-style file with coordinates for d2zdhd2.
(The format of our PDB-style files is described here.)

Timeline for d2zdhd2: