Lineage for d1a6zc1 (1a6z C:182-275)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 52922Species Human (Homo sapiens), hemochromatosis protein Hfe [TaxId:9606] [48958] (2 PDB entries)
  8. 52931Domain d1a6zc1: 1a6z C:182-275 [20783]
    Other proteins in same PDB: d1a6za2, d1a6zc2

Details for d1a6zc1

PDB Entry: 1a6z (more details), 2.6 Å

PDB Description: hfe (human) hemochromatosis protein

SCOP Domain Sequences for d1a6zc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6zc1 b.1.1.2 (C:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), hemochromatosis protein Hfe}
qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt
yqgwitlavppgeeqrytcqvehpgldqpliviw

SCOP Domain Coordinates for d1a6zc1:

Click to download the PDB-style file with coordinates for d1a6zc1.
(The format of our PDB-style files is described here.)

Timeline for d1a6zc1: