Lineage for d2zdgb2 (2zdg B:115-319)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217789Species Thermus thermophilus HB8 [TaxId:300852] [225373] (6 PDB entries)
  8. 2217795Domain d2zdgb2: 2zdg B:115-319 [207825]
    Other proteins in same PDB: d2zdga1, d2zdgb1, d2zdgc1, d2zdgd1
    automated match to d1e4ea2
    complexed with adp, mg

Details for d2zdgb2

PDB Entry: 2zdg (more details), 2.2 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ADP from Thermus thermophius HB8
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdgb2:

Sequence, based on SEQRES records: (download)

>d2zdgb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Sequence, based on observed residues (ATOM records): (download)

>d2zdgb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeaellipapldtqetv
qelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggvaypell
rrlvelalt

SCOPe Domain Coordinates for d2zdgb2:

Click to download the PDB-style file with coordinates for d2zdgb2.
(The format of our PDB-style files is described here.)

Timeline for d2zdgb2: