SCOPe 2.04: Domain d2zdga1: 2zdg A:1-114

Lineage for d2zdga1 (2zdg A:1-114)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (25 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [226603] (4 PDB entries)

8. Domain d2zdga1: 2zdg A:1-114 [207822]
   Other proteins in same PDB: d2zdga2, d2zdgb2, d2zdgc2, d2zdgd2
   automated match to d1e4ea1
   complexed with adp, mg

Details for d2zdga1

PDB Entry: 2zdg, 2.2 Å

PDB Description: Crystal structure of D-Alanine:D-Alanine Ligase with ADP from Thermus thermophius HB8

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2zdga1:

Sequence; same for both SEQRES and ATOM records:

>d2zdga1 c.30.1.0 (A:1-114) automated matches {Thermus thermophilus [TaxId: 274]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

Timeline for d2zdga1:

• d2zdga1 first appeared in SCOPe 2.03
  
• d2zdga1 appears in SCOPe 2.05
  
• d2zdga1 appears in the current release, SCOPe 2.08