Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (91 PDB entries) |
Domain d1a6zb_: 1a6z B: [20782] Other proteins in same PDB: d1a6za1, d1a6za2, d1a6zc1, d1a6zc2 |
PDB Entry: 1a6z (more details), 2.6 Å
SCOP Domain Sequences for d1a6zb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a6zb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens)} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1a6zb_: