SCOPe 2.06: Domain d2zc8a1: 2zc8 A:1-125

Lineage for d2zc8a1 (2zc8 A:1-125)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225415] (1 PDB entry)

8. Domain d2zc8a1: 2zc8 A:1-125 [207810]
   Other proteins in same PDB: d2zc8a2, d2zc8b2
   automated match to d1wuea2

Details for d2zc8a1

PDB Entry: 2zc8, 1.95 Å

PDB Description: Crystal structure of N-Acylamino Acid Racemase from Thermus thermophilus HB8

PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d2zc8a1:

Sequence; same for both SEQRES and ATOM records:

>d2zc8a1 d.54.1.0 (A:1-125) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrieaaelrilelplkfrfetsfgvqtkrtilllrlfgegleglgegvmerlplyreetv
agarylleevflprvlgrdlpnpealrealapfrgnpmakavlemaffdlwakalgrplw
qvlgg

Timeline for d2zc8a1:

• d2zc8a1 first appeared in SCOPe 2.03
  
• d2zc8a1 appears in SCOPe 2.05
  
• d2zc8a1 appears in SCOPe 2.07
  
• d2zc8a1 appears in the current release, SCOPe 2.08