Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [225415] (1 PDB entry) |
Domain d2zc8a1: 2zc8 A:1-125 [207810] Other proteins in same PDB: d2zc8a2, d2zc8b2 automated match to d1wuea2 |
PDB Entry: 2zc8 (more details), 1.95 Å
SCOPe Domain Sequences for d2zc8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zc8a1 d.54.1.0 (A:1-125) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mrieaaelrilelplkfrfetsfgvqtkrtilllrlfgegleglgegvmerlplyreetv agarylleevflprvlgrdlpnpealrealapfrgnpmakavlemaffdlwakalgrplw qvlgg
Timeline for d2zc8a1: