SCOP 1.63: Domain d1a6za1: 1a6z A:182-275

Lineage for d1a6za1 (1a6z A:182-275)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)

7. Species Human (Homo sapiens), hemochromatosis protein Hfe [TaxId:9606] [48958] (2 PDB entries)

8. Domain d1a6za1: 1a6z A:182-275 [20781]
   Other proteins in same PDB: d1a6za2, d1a6zc2

Details for d1a6za1

PDB Entry: 1a6z, 2.6 Å

PDB Description: hfe (human) hemochromatosis protein

SCOP Domain Sequences for d1a6za1:

Sequence; same for both SEQRES and ATOM records:

>d1a6za1 b.1.1.2 (A:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), hemochromatosis protein Hfe}
qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt
yqgwitlavppgeeqrytcqvehpgldqpliviw

Timeline for d1a6za1:

• d1a6za1 first appeared (with stable ids) in SCOP 1.55
  
• d1a6za1 appears in SCOP 1.61
  
• d1a6za1 appears in SCOP 1.65
  
• d1a6za1 appears in the current release, SCOPe 2.08