SCOPe 2.06: Domain d2zaya_: 2zay A:

Lineage for d2zaya_ (2zay A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Desulfuromonas acetoxidans [TaxId:281689] [225364] (1 PDB entry)

8. Domain d2zaya_: 2zay A: [207808]
   automated match to d3to5a_

Details for d2zaya_

PDB Entry: 2zay, 2 Å

PDB Description: crystal structure of response regulator from desulfuromonas acetoxidans

PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d2zaya_:

Sequence; same for both SEQRES and ATOM records:

>d2zaya_ c.23.1.0 (A:) automated matches {Desulfuromonas acetoxidans [TaxId: 281689]}
wwrimlvdtqlpalaasisalsqegfdiiqcgnaieavpvavkthphliiteanmpkisg
mdlfnslkknpqtasipvialsgratakeeaqlldmgfidfiakpvnairlsarikrvlk
lly

Timeline for d2zaya_:

• d2zaya_ first appeared in SCOPe 2.03
  
• d2zaya_ appears in SCOPe 2.05
  
• d2zaya_ appears in SCOPe 2.07
  
• d2zaya_ appears in the current release, SCOPe 2.08