SCOPe 2.04: Domain d2zadd2: 2zad D:125-345

Lineage for d2zadd2 (2zad D:125-345)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (59 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries)

8. Domain d2zadd2: 2zad D:125-345 [207803]
   Other proteins in same PDB: d2zada1, d2zadb1, d2zadc1, d2zadd1
   automated match to d1jpma1
   complexed with 1pe, mn, peg

Details for d2zadd2

PDB Entry: 2zad, 1.6 Å

PDB Description: Crystal Structure of Muconate Cycloisomerase from Thermotoga maritima MSB8

PDB Compounds: (D:) Muconate cycloisomerase

SCOPe Domain Sequences for d2zadd2:

Sequence; same for both SEQRES and ATOM records:

>d2zadd2 c.1.11.0 (D:125-345) automated matches {Thermotoga maritima [TaxId: 243274]}
krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak
yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa
rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv
hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq

Timeline for d2zadd2:

• d2zadd2 first appeared in SCOPe 2.03
  
• d2zadd2 appears in SCOPe 2.05
  
• d2zadd2 appears in the current release, SCOPe 2.08