Lineage for d2zadc2 (2zad C:125-345)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837832Species Thermotoga maritima [TaxId:243274] [225440] (5 PDB entries)
  8. 2837835Domain d2zadc2: 2zad C:125-345 [207801]
    Other proteins in same PDB: d2zada1, d2zadb1, d2zadc1, d2zadd1
    automated match to d1jpma1
    complexed with 1pe, mn, peg

Details for d2zadc2

PDB Entry: 2zad (more details), 1.6 Å

PDB Description: Crystal Structure of Muconate Cycloisomerase from Thermotoga maritima MSB8
PDB Compounds: (C:) Muconate cycloisomerase

SCOPe Domain Sequences for d2zadc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zadc2 c.1.11.0 (C:125-345) automated matches {Thermotoga maritima [TaxId: 243274]}
krdeietdktvgidtvenrvkeakkifeegfrvikikvgenlkedieaveeiakvtrgak
yivdanmgytqkeavefaravyqkgidiavyeqpvrredieglkfvrfhspfpvaadesa
rtkfdvmrlvkeeavdyvniklmksgisdalaiveiaessglklmigcmgesslginqsv
hfalgtgafefhdldshlmlkeevfrgkfiqdgprmrvkdq

SCOPe Domain Coordinates for d2zadc2:

Click to download the PDB-style file with coordinates for d2zadc2.
(The format of our PDB-style files is described here.)

Timeline for d2zadc2: