Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (67 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [225439] (5 PDB entries) |
Domain d2zadc1: 2zad C:2-124 [207800] Other proteins in same PDB: d2zada2, d2zadb2, d2zadc2, d2zadd2 automated match to d1jpma2 complexed with 1pe, mn, peg |
PDB Entry: 2zad (more details), 1.6 Å
SCOPe Domain Sequences for d2zadc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zadc1 d.54.1.0 (C:2-124) automated matches {Thermotoga maritima [TaxId: 243274]} srivnvklslkryeyekpfhitgsvssesrnveveivlesgvkgygeaspsfrvngerve allaienavremitgidvrnyarifeitdrlfgfpslkaavqfatldalsqelgtqvcyl lgg
Timeline for d2zadc1: