![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
![]() | Species Human (Homo sapiens), hemochromatosis protein Hfe [TaxId:9606] [48958] (2 PDB entries) |
![]() | Domain d1de4g1: 1de4 G:182-275 [20779] Other proteins in same PDB: d1de4a2, d1de4c1, d1de4c2, d1de4c3, d1de4d2, d1de4f1, d1de4f2, d1de4f3, d1de4g2, d1de4i1, d1de4i2, d1de4i3 |
PDB Entry: 1de4 (more details), 2.8 Å
SCOP Domain Sequences for d1de4g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1de4g1 b.1.1.2 (G:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), hemochromatosis protein Hfe} qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt yqgwitlavppgeeqrytcqvehpgldqpliviw
Timeline for d1de4g1: