Lineage for d1de4g1 (1de4 G:182-275)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8170Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 8173Species Human (Homo sapiens), hemochromatosis protein Hfe [TaxId:9606] [48958] (2 PDB entries)
  8. 8178Domain d1de4g1: 1de4 G:182-275 [20779]
    Other proteins in same PDB: d1de4a2, d1de4c1, d1de4c2, d1de4c3, d1de4d2, d1de4f1, d1de4f2, d1de4f3, d1de4g2, d1de4i1, d1de4i2, d1de4i3

Details for d1de4g1

PDB Entry: 1de4 (more details), 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor

SCOP Domain Sequences for d1de4g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1de4g1 b.1.1.2 (G:182-275) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), hemochromatosis protein Hfe}
qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt
yqgwitlavppgeeqrytcqvehpgldqpliviw

SCOP Domain Coordinates for d1de4g1:

Click to download the PDB-style file with coordinates for d1de4g1.
(The format of our PDB-style files is described here.)

Timeline for d1de4g1: