Lineage for d2z7ea_ (2z7e A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007772Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 3007773Protein automated matches [190942] (7 species)
    not a true protein
  7. 3007774Species Aquifex aeolicus [TaxId:63363] [225504] (1 PDB entry)
  8. 3007775Domain d2z7ea_: 2z7e A: [207781]
    automated match to d2qq4f_
    complexed with fes, so4

Details for d2z7ea_

PDB Entry: 2z7e (more details), 2.3 Å

PDB Description: crystal structure of aquifex aeolicus iscu with bound [2fe-2s] cluster
PDB Compounds: (A:) NifU-like protein

SCOPe Domain Sequences for d2z7ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z7ea_ d.224.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
msfeynekvldhflnprnvgvledangvgqcgnpacgaamlftikvnpendviedvrfkt
fgcgsaiavssmltemvkgkpiqyalnltykdifeelgglppqkihctnlgletlhvaik
dylmkqgrveeaskipdcy

SCOPe Domain Coordinates for d2z7ea_:

Click to download the PDB-style file with coordinates for d2z7ea_.
(The format of our PDB-style files is described here.)

Timeline for d2z7ea_: