Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (369 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d1de4e_: 1de4 E: [20778] Other proteins in same PDB: d1de4a1, d1de4a2, d1de4c1, d1de4c2, d1de4c3, d1de4d1, d1de4d2, d1de4f1, d1de4f2, d1de4f3, d1de4g1, d1de4g2, d1de4i1, d1de4i2, d1de4i3 complexed with ca, gol, nag |
PDB Entry: 1de4 (more details), 2.8 Å
SCOPe Domain Sequences for d1de4e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1de4e_ b.1.1.2 (E:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1de4e_: