Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) |
Family d.139.1.0: automated matches [227182] (1 protein) not a true family |
Protein automated matches [226902] (12 species) not a true protein |
Species Geobacillus kaustophilus [TaxId:1462] [225375] (1 PDB entry) |
Domain d2z01a2: 2z01 A:168-342 [207762] Other proteins in same PDB: d2z01a1 automated match to d1clia2 |
PDB Entry: 2z01 (more details), 2.2 Å
SCOPe Domain Sequences for d2z01a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z01a2 d.139.1.0 (A:168-342) automated matches {Geobacillus kaustophilus [TaxId: 1462]} tgetiqagdalvglpssglhsngyslvrrivfeqaklsldeiyepldvplgeellkptri yakllrsvrerftikgmahitggglieniprmlppgigariqlgswpilpifdflrekgs leeeemfsvfnmgiglvlavspetaaplvewlsergepayiigevakgagvsfag
Timeline for d2z01a2: