SCOPe 2.08: Domain d2z01a2: 2z01 A:168-342

Lineage for d2z01a2 (2z01 A:168-342)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.0: automated matches [227182] (1 protein)
   not a true family

6. Protein automated matches [226902] (12 species)
   not a true protein

7. Species Geobacillus kaustophilus [TaxId:1462] [225375] (1 PDB entry)

8. Domain d2z01a2: 2z01 A:168-342 [207762]
   Other proteins in same PDB: d2z01a1
   automated match to d1clia2

Details for d2z01a2

PDB Entry: 2z01, 2.2 Å

PDB Description: crystal structure of phosphoribosylaminoimidazole synthetase from geobacillus kaustophilus

PDB Compounds: (A:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d2z01a2:

Sequence; same for both SEQRES and ATOM records:

>d2z01a2 d.139.1.0 (A:168-342) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
tgetiqagdalvglpssglhsngyslvrrivfeqaklsldeiyepldvplgeellkptri
yakllrsvrerftikgmahitggglieniprmlppgigariqlgswpilpifdflrekgs
leeeemfsvfnmgiglvlavspetaaplvewlsergepayiigevakgagvsfag

Timeline for d2z01a2:

• d2z01a2 first appeared in SCOPe 2.03
  
• d2z01a2 appears in SCOPe 2.07