![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (67 PDB entries) |
![]() | Domain d1de4b_: 1de4 B: [20776] Other proteins in same PDB: d1de4a1, d1de4a2, d1de4c1, d1de4c2, d1de4c3, d1de4d1, d1de4d2, d1de4f1, d1de4f2, d1de4f3, d1de4g1, d1de4g2, d1de4i1, d1de4i2, d1de4i3 |
PDB Entry: 1de4 (more details), 2.8 Å
SCOP Domain Sequences for d1de4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1de4b_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens)} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1de4b_: