Lineage for d2yzma1 (2yzm A:1-114)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2120504Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2120505Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2120847Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2120848Protein automated matches [226903] (35 species)
    not a true protein
  7. 2120978Species Thermus thermophilus HB8 [TaxId:300852] [225372] (3 PDB entries)
  8. 2120979Domain d2yzma1: 2yzm A:1-114 [207749]
    Other proteins in same PDB: d2yzma2, d2yzmb2, d2yzmc2
    automated match to d1e4ea1
    complexed with dal

Details for d2yzma1

PDB Entry: 2yzm (more details), 2.21 Å

PDB Description: structure of d-alanine:d-alanine ligase with substrate from thermus thermophilus hb8
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2yzma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzma1 c.30.1.0 (A:1-114) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

SCOPe Domain Coordinates for d2yzma1:

Click to download the PDB-style file with coordinates for d2yzma1.
(The format of our PDB-style files is described here.)

Timeline for d2yzma1: