Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (18 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [225373] (6 PDB entries) |
Domain d2yzgb2: 2yzg B:115-319 [207746] Other proteins in same PDB: d2yzga1, d2yzgb1, d2yzgc1 automated match to d1e4ea2 |
PDB Entry: 2yzg (more details), 2.3 Å
SCOPe Domain Sequences for d2yzgb2:
Sequence, based on SEQRES records: (download)
>d2yzgb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus [TaxId: 300852]} dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm yprlfeaggvaypellrrlvelalt
>d2yzgb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus [TaxId: 300852]} dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfpgraellipapl dpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeag gvaypellrrlvelalt
Timeline for d2yzgb2:
View in 3D Domains from other chains: (mouse over for more information) d2yzga1, d2yzga2, d2yzgc1, d2yzgc2 |