Lineage for d2yzga2 (2yzg A:115-319)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432977Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 1432978Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) (S)
  5. 1433300Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 1433301Protein automated matches [226904] (18 species)
    not a true protein
  7. 1433357Species Thermus thermophilus [TaxId:300852] [225373] (6 PDB entries)
  8. 1433371Domain d2yzga2: 2yzg A:115-319 [207744]
    Other proteins in same PDB: d2yzga1, d2yzgb1, d2yzgc1
    automated match to d1e4ea2

Details for d2yzga2

PDB Entry: 2yzg (more details), 2.3 Å

PDB Description: crystal structure of d-ala:d-ala ligase from thermus thermophilus hb8
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2yzga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzga2 d.142.1.0 (A:115-319) automated matches {Thermus thermophilus [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

SCOPe Domain Coordinates for d2yzga2:

Click to download the PDB-style file with coordinates for d2yzga2.
(The format of our PDB-style files is described here.)

Timeline for d2yzga2: