Lineage for d2yxsa_ (2yxs A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308833Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1308834Protein automated matches [190437] (23 species)
    not a true protein
  7. 1308935Species Human (Homo sapiens) [TaxId:9606] [187655] (29 PDB entries)
  8. 1308970Domain d2yxsa_: 2yxs A: [207738]
    automated match to d2yv8a_
    complexed with lat

Details for d2yxsa_

PDB Entry: 2yxs (more details), 2.13 Å

PDB Description: Crystal Sturcture of N-terminal domain of human galectin-8 with D-lactose
PDB Compounds: (A:) Galectin-8 variant

SCOPe Domain Sequences for d2yxsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yxsa_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqniiynpvipyvgtipdqldpgtlivicghvpsdadrfqvdlqngssvkpradvafhfn
prfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavngkhtllyg
hrigpekidtlgiygkvnihsigfsgpssg

SCOPe Domain Coordinates for d2yxsa_:

Click to download the PDB-style file with coordinates for d2yxsa_.
(The format of our PDB-style files is described here.)

Timeline for d2yxsa_: