Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries) |
Domain d1mhec1: 1mhe C:182-274 [20773] Other proteins in same PDB: d1mhea2, d1mheb_, d1mhec2, d1mhed_ complexed with so4 |
PDB Entry: 1mhe (more details), 2.85 Å
SCOP Domain Sequences for d1mhec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhec1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens)} leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf qkwaavvvpsgeeqrytchvqheglpepvtlrw
Timeline for d1mhec1:
View in 3D Domains from other chains: (mouse over for more information) d1mhea1, d1mhea2, d1mheb_, d1mhed_ |