Lineage for d1mhec1 (1mhe C:182-274)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8170Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 8297Species Human (Homo sapiens), HLA-E [TaxId:9606] [48957] (1 PDB entry)
  8. 8300Domain d1mhec1: 1mhe C:182-274 [20773]
    Other proteins in same PDB: d1mhea2, d1mhec2

Details for d1mhec1

PDB Entry: 1mhe (more details), 2.85 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla-e

SCOP Domain Sequences for d1mhec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhec1 b.1.1.2 (C:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-E}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepvtlrw

SCOP Domain Coordinates for d1mhec1:

Click to download the PDB-style file with coordinates for d1mhec1.
(The format of our PDB-style files is described here.)

Timeline for d1mhec1: