Lineage for d2yv2a2 (2yv2 A:129-295)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838358Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 1838359Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 1838366Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (5 species)
  7. 1838367Species Aeropyrum pernix [TaxId:272557] [225352] (1 PDB entry)
  8. 1838368Domain d2yv2a2: 2yv2 A:129-295 [207721]
    Other proteins in same PDB: d2yv2a1
    automated match to d1euda2

Details for d2yv2a2

PDB Entry: 2yv2 (more details), 2.2 Å

PDB Description: Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Aeropyrum pernix K1
PDB Compounds: (A:) succinyl-coa synthetase alpha chain

SCOPe Domain Sequences for d2yv2a2:

Sequence, based on SEQRES records: (download)

>d2yv2a2 c.23.4.1 (A:129-295) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Aeropyrum pernix [TaxId: 272557]}
ncpgaitpgqakvgimpghifkeggvavvsrsgtltyeisymltrqgigqstvigiggdp
ivglsftealklfqedpqtealvligeiggdmeeraaemikkgeftkpviayiagrtapp
ekrmghagaiimmgtgtyegkvkalreagvevaetpfevpelvrkal

Sequence, based on observed residues (ATOM records): (download)

>d2yv2a2 c.23.4.1 (A:129-295) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Aeropyrum pernix [TaxId: 272557]}
ncpgaitpgqakvgimpghifkeggvavvsrsgtltyeisymltrqgigqstvigiggdp
ivglsftealklfqedpqtealvligeiggdmeeraaemikkgeftkpviayiagrtgty
egkvkalreagvevaetpfevpelvrkal

SCOPe Domain Coordinates for d2yv2a2:

Click to download the PDB-style file with coordinates for d2yv2a2.
(The format of our PDB-style files is described here.)

Timeline for d2yv2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yv2a1